PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00136g00115.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 303aa    MW: 33620.1 Da    PI: 9.4803
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00136g00115.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding445.2e-14118162347
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               +WT+eE+ +++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
  Peaxi162Scf00136g00115.1 118 PWTEEEHRIFLLGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 162
                               8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.108.6E-4320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129417.838111167IPR017930Myb domain
SuperFamilySSF466899.72E-18113168IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-18114166IPR006447Myb domain, plants
SMARTSM007172.6E-11115165IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-11115161IPR009057Homeodomain-like
PfamPF002492.0E-11118162IPR001005SANT/Myb domain
CDDcd001678.50E-10118163No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MGRKCSHCGI TGHNSRTCKT QNLTKVDEET EDATTYNIGL KLFGVKLEIP KSSSSCVSMK  60
KSFSVGCLSK ISSSTTGSFV SNINCQMFMD HENMDKVSNG YLSDVLVGRT SDKKKGVPWT  120
EEEHRIFLLG LEKLGKGDWR GISRNFVTTR TPTQVASHAQ KYFLRQNSLN RKKRRRSLFD  180
EVGMDKSTIL LFDKSVTTKT NGTCITNISY EKSPDDETMI SMINFSTSLS KDSKSSTSQH  240
SMPATTLVNL PFINSSNNFT CHNISVQDSA KPDLELTLAV SKPLNNQRRQ PGCLNAENSI  300
AVI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAPTransfer from AT5G56840Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0108942e-62AP010894.1 Solanum lycopersicum DNA, chromosome 8, clone: C08HBa0017M21, complete sequence.
GenBankHG9755202e-62HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009631208.11e-139PREDICTED: myb-like protein J
RefseqXP_009780709.11e-138PREDICTED: myb-like protein H isoform X1
RefseqXP_016450793.11e-138PREDICTED: myb-like protein H isoform X1
RefseqXP_016498568.11e-139PREDICTED: myb-like protein J
TrEMBLK4CLB87e-95K4CLB8_SOLLC; Uncharacterized protein
STRINGSolyc08g065380.2.12e-94(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33852147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.12e-47MYB_related family protein